Retatrutide 10mg

$45.00

SKU: RETA10 Category: Peptide Tags: Peptide, Retatrutide

Product Name	Retatrutide 10mg
Supplied	1 vial containing 10 mg lyophilised peptide powder
CAS Number	2381089-83-2
Molecular Formula	C221H342N46O68
Molecular Weight	4730.9 g/mol
Peptide Sequence	YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS-NH₂ (Aib at 2 and 20; α-methyl-Leu at 13; Lys17 acylated with a C20 fatty diacid via γGlu–AEEA linker)
Purity	≥98% (HPLC verified)
Appearance	White to off-white lyophilised powder

Flatsome Elements